PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009605529.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 527aa    MW: 58216.7 Da    PI: 6.9467
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009605529.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.29.4e-30245302260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     +DgynWrKYGqK v+g+ef+rsYY+Cts++C +kk+vers+ d+++++i+Y  +H+h+k
  XP_009605529.1 245 EDGYNWRKYGQKLVRGNEFTRSYYKCTSPNCLAKKQVERSH-DGHITNIHYIAKHEHPK 302
                     7****************************************.***************85 PP

2WRKY105.33.2e-33422480159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ++Dgy+WrKYGqK vkg+++prsYYrC+sagCp+kk+ver+++dpk+v++ Yeg+H+he
  XP_009605529.1 422 VNDGYRWRKYGQKLVKGNPNPRSYYRCSSAGCPAKKHVERASHDPKLVVTAYEGQHDHE 480
                     58********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.1E-26238303IPR003657WRKY domain
PROSITE profilePS5081123.227239303IPR003657WRKY domain
SuperFamilySSF1182902.22E-23241303IPR003657WRKY domain
SMARTSM007749.3E-32244302IPR003657WRKY domain
PfamPF031063.2E-22245301IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.2E-34408482IPR003657WRKY domain
SuperFamilySSF1182908.11E-29414482IPR003657WRKY domain
PROSITE profilePS5081135.645417482IPR003657WRKY domain
SMARTSM007743.5E-38422481IPR003657WRKY domain
PfamPF031063.7E-26423479IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 527 aa     Download sequence    Send to blast
MGTHNKDVTD EVSSEKLQQK QDLDAVTYRS ELKEKEICES MSAEVISGEL QKRVSPDALE  60
KSSQSNQDEN ALSTTCQEVS GEVKPKKSVV EGIEKFQQKP DPDTVTNRSE SKEKGTCDSV  120
SAEVVSDELL KGLSPDSLAK ASESSRVSVL PKKEPYIKSC ESDSPVKDRN VSLVPGKASE  180
SSQHIQREKM EVVVSQPNQE QVTCSIRPEK ALDKLQPRRN LDTSVQALPS DQEITPFRSP  240
EKPSEDGYNW RKYGQKLVRG NEFTRSYYKC TSPNCLAKKQ VERSHDGHIT NIHYIAKHEH  300
PKPLDSPQIS PEFVVPMQLK QTNMPMGTPR EAEGKKSIVI GQTCQSIEPS ESSLSAVIVP  360
AGGSATDTVL KPHKSGDEAD NSGGPDPKRQ KREVPRSDEI PPIKSHSEPQ HIVQTRSEVD  420
IVNDGYRWRK YGQKLVKGNP NPRSYYRCSS AGCPAKKHVE RASHDPKLVV TAYEGQHDHE  480
IPPSRTVMQN SAGADSNNTT RISGESTSES GENKHVGLDR VVHIGAN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A4e-34246483475WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754461e-173HG975446.1 Solanum pennellii chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009605529.10.0PREDICTED: WRKY transcription factor 1-like
TrEMBLM1A6I40.0M1A6I4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000157540.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45582242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.26e-73zinc-dependent activator protein-1